Query author contributions in Reactome
Reactome depends on collaboration between our curation team and outside experts to assemble and peer-review its pathway modules. The integration of ORCID within Reactome enables us to meet a key challenge with authoring, curating and reviewing biological information by incentivizing and crediting the external experts that contribute their expertise and time to the Reactome curation process. More information is available at ORCID and Reactome.
If you have an ORCID ID that is not listed on this page, please forward this information to us and we will update your Reactome pathway records.
Details on Person UniProt:P78381 SLC35A2
| Class:Id | ReferenceGeneProduct:66946 |
|---|---|
| _chainChangeLog | chain:1-396 added on Fri February 6 2015 |
| _displayName | UniProt:P78381 SLC35A2 |
| _timestamp | 2025-02-21 19:12:12 |
| chain | chain:1-396 |
| checksum | 6EC1DC9532FE9221 |
| comment | FUNCTION Transports uridine diphosphate galactose (UDP-galactose) from the cytosol into the Golgi apparatus, functioning as an antiporter that exchanges UDP-galactose for UMP (PubMed:12682060, PubMed:9010752). It is also able to exchange UDP-galactose for AMP and CMP, and to transport UDP-N-acetylgalactosamine (UDP-GalNAc) and other nucleotide sugars (PubMed:11784306, PubMed:12682060). As a provider of UDP-galactose to galactosyltransferases present in the Golgi apparatus, it is necessary for globotriaosylceramide/globoside (Gb3Cer) synthesis from lactosylceramide (PubMed:30817854).CATALYTIC ACTIVITY UMP(out) + UDP-alpha-D-galactose(in) = UMP(in) + UDP-alpha-D-galactose(out)CATALYTIC ACTIVITY UDP-N-acetyl-alpha-D-galactosamine(in) + UMP(out) = UDP-N-acetyl-alpha-D-galactosamine(out) + UMP(in)CATALYTIC ACTIVITY UMP(out) + UDP-alpha-D-glucose(in) = UMP(in) + UDP-alpha-D-glucose(out)CATALYTIC ACTIVITY UMP(out) + UDP-N-acetyl-alpha-D-glucosamine(in) = UMP(in) + UDP-N-acetyl-alpha-D-glucosamine(out)CATALYTIC ACTIVITY UDP-alpha-D-galactose(in) + AMP(out) = UDP-alpha-D-galactose(out) + AMP(in)CATALYTIC ACTIVITY UDP-alpha-D-galactose(in) + CMP(out) = UDP-alpha-D-galactose(out) + CMP(in)CATALYTIC ACTIVITY UDP-N-acetyl-alpha-D-galactosamine(out) + UDP-alpha-D-galactose(in) = UDP-N-acetyl-alpha-D-galactosamine(in) + UDP-alpha-D-galactose(out)CATALYTIC ACTIVITY UDP-N-acetyl-alpha-D-glucosamine(out) + UDP-alpha-D-galactose(in) = UDP-N-acetyl-alpha-D-glucosamine(in) + UDP-alpha-D-galactose(out)CATALYTIC ACTIVITY UDP-alpha-D-galactose(in) + UDP-alpha-D-glucose(out) = UDP-alpha-D-galactose(out) + UDP-alpha-D-glucose(in)CATALYTIC ACTIVITY UMP(out) + CMP(in) = UMP(in) + CMP(out)CATALYTIC ACTIVITY UMP(out) + AMP(in) = UMP(in) + AMP(out)BIOPHYSICOCHEMICAL PROPERTIES Interacts with SLC35A3; the interaction is reduced in the presence of SLC35A4 (PubMed:23089177, PubMed:28167211). Found in a complex with SLC35A3 and SLC35A4 (PubMed:28167211).SUBUNIT Interacts with B4GALT4.INTERACTION The disease is caused by variants affecting the gene represented in this entry.SIMILARITY Belongs to the nucleotide-sugar transporter family. SLC35A subfamily. |
| description | recommendedName: fullName evidence="26"UDP-galactose translocator alternativeName: fullName evidence="27"Solute carrier family 35 member A2 alternativeName: UDP-galactose transporter shortName: UDP-Gal-Tr shortName: UGT |
| geneName | SLC35A2 UGALT UGT UGTL |
| identifier | P78381 |
| isSequenceChanged | FALSE |
| keyword | Alternative splicing Antiport Congenital disorder of glycosylation Disease variant Endoplasmic reticulum Epilepsy Golgi apparatus Membrane Proteomics identification Reference proteome Sugar transport Transmembrane Transmembrane helix Transport |
| modified | [InstanceEdit:9836292] Weiser, Joel, 2023-05-25 [InstanceEdit:9852000] Weiser, Joel, 2023-11-03 [InstanceEdit:9917590] Weiser, Joel, 2024-08-09 [InstanceEdit:9926675] Weiser, Joel, 2024-11-03 [InstanceEdit:9939033] Weiser, Joel, 2025-02-21 |
| name | SLC35A2 |
| referenceDatabase | [ReferenceDatabase:2] UniProt |
| referenceGene | [ReferenceDNASequence:8992120] ENSEMBL:ENSG00000102100 SLC35A2 [Homo sapiens] |
| secondaryIdentifier | S35A2_HUMAN A8K2L9 A8K9V1 B4DE11 B4DPT2 E7EW45 Q8IV21 Q92553 |
| sequenceLength | 396 |
| species | [Species:48887] Homo sapiens |
| (isoformParent) | [ReferenceIsoform:155529] UniProt:P78381-2 SLC35A2 [Homo sapiens] [ReferenceIsoform:404827] UniProt:P78381-1 SLC35A2 [Homo sapiens] [ReferenceIsoform:8971175] UniProt:P78381-3 SLC35A2 [Homo sapiens] [ReferenceIsoform:8971176] UniProt:P78381-4 SLC35A2 [Homo sapiens] [ReferenceIsoform:8971177] UniProt:P78381-5 SLC35A2 [Homo sapiens] |
| (referenceEntity) | [EntityWithAccessionedSequence:735686] SLC35A2 [Golgi membrane] [Homo sapiens] [EntityWithAccessionedSequence:5652088] SLC35A2 F324Lfs*25 [Golgi membrane] [Homo sapiens] [EntityWithAccessionedSequence:5652093] SLC35A2 V331I [Golgi membrane] [Homo sapiens] [EntityWithAccessionedSequence:5652101] SLC35A2 M1? [Golgi membrane] [Homo sapiens] [EntityWithAccessionedSequence:5652107] SLC35A2 G8Sfs*9 [Golgi membrane] [Homo sapiens] [EntityWithAccessionedSequence:5652114] SLC35A2 Y145Pfs*76 [Golgi membrane] [Homo sapiens] |
| (referenceSequence) | [FragmentReplacedModification:5652086] Replacement of residues 324 to 347 by LPLALDSSLVLSTSTAFPEVQPKP [FragmentReplacedModification:5652119] Replacement of residues 145 to 219 by PAEDPDHSAVLRAHAESQPFPAAVGLPAAPLHWRRHCPGTASRWGRPTATGSEPWGRPGSRRGLLSLLRLRRCLL [ReplacedResidue:5652123] L-valine 331 replaced with L-isoleucine [FragmentReplacedModification:5652127] Replacement of residues 8 to 15 by SRECSSLK [ReplacedResidue:5652130] L-methionine 1 replaced with unknown [FragmentDeletionModification:9830731] Deletion of residues 1 to 72 |
| [Change default viewing format] | |
No pathways have been reviewed or authored by UniProt:P78381 SLC35A2 (66946)
