Query author contributions in Reactome
Reactome depends on collaboration between our curation team and outside experts to
assemble and peer-review its pathway modules. The integration of ORCID within Reactome
enables us to meet a key challenge with authoring, curating and reviewing biological
information by incentivizing and crediting the external experts that contribute their
expertise and time to the Reactome curation process. More information is available at
ORCID and Reactome.
If you have an ORCID ID that is not listed on this page, please
forward this information to us and we will update your Reactome pathway records.
Details on Person Jassal, B, 2013-10-17
| Class:Id | InstanceEdit:4717398 |
| _displayName | Jassal, B, 2013-10-17 |
| _timestamp | 2013-10-17 13:48:55 |
| author | [Person:73447] Jassal, Bijay |
| dateTime | 2013-10-17 17:47:00 |
| (authored) | [Pathway:4717374] Defective DPM1 causes DPM1-CDG [Homo sapiens] [FailedReaction:4717406] Defective DPM1 does not transfer mannose to DOLP to form DOLPman [Homo sapiens] |
| (created) | [Person:4717348] Korn-Lubetzki, I [Person:4717349] Sagi, D [Person:4717350] Karnes, P S [Person:4717351] Kreissel, G [ReplacedResidue:4717352] L-methionine 1 replaced with L-threonine [Person:4717353] Bailie, N M [FragmentReplacedModification:4717354] Replacement of residues 111 to 154 by LLWMLISHTIQNLFLNLLGSKRRVILILSLELATKEMEVYMAGI [Person:4717355] Sanchez del Pozo, J [Summation:4717356] Dolichyl-phosphate mannosyltransferase (DPM), a heterotrimer... [Person:4717357] Jackowski-Dohrmann, S |
| (edited) | [Pathway:4717374] Defective DPM1 causes DPM1-CDG [Homo sapiens] [FailedReaction:4717406] Defective DPM1 does not transfer mannose to DOLP to form DOLPman [Homo sapiens] |
| (modified) | [Complex:162692] DPM1:DPM2:DPM3 [endoplasmic reticulum membrane] [Homo sapiens] [CatalystActivity:162705] dolichyl-phosphate beta-D-mannosyltransferase activity of DPM1:DPM2:DPM3 [endoplasmic reticulum membrane] [Summation:162784] Cytosolic GDP-mannose reacts with dolichyl phosphate in the ... [Pathway:3781860] Diseases associated with N-glycosylation of proteins [Homo sapiens] [FailedReaction:4686998] Defective MPDU1 does not promote transfer of Man to N-glycan precursor (GlcNAc)2 (Man)7 (PP-Dol)1 by ALG12 [Homo sapiens] [Pathway:4687000] Defective MPDU1 causes CDG-1f [Homo sapiens] [Summation:4687001] Mannose-P-dolichol utilisation defect 1 protein (MPDU1) is r... [FailedReaction:9036020] Defective MPDU1 does not promote transfer of Man to (GlcNAc)2 (Man)8 (PP-Dol)1 by ALG9 [Homo sapiens] [FailedReaction:9036021] Defective MPDU1 does not promote transfer of Man to (GlcNAc)2 (Man)6 (PP-Dol)1 by ALG9 [Homo sapiens] [FailedReaction:9036025] Defective MPDU1 does not promote transfer of Man to (GlcNAc)2 (Man)5 (PP-Dol)1 by ALG3 [Homo sapiens] |
|
[Change default viewing format]
|
No pathways have been reviewed or authored by Jassal, B, 2013-10-17 (4717398)