Query author contributions in Reactome

Reactome depends on collaboration between our curation team and outside experts to assemble and peer-review its pathway modules. The integration of ORCID within Reactome enables us to meet a key challenge with authoring, curating and reviewing biological information by incentivizing and crediting the external experts that contribute their expertise and time to the Reactome curation process. More information is available at ORCID and Reactome.

If you have an ORCID ID that is not listed on this page, please forward this information to us and we will update your Reactome pathway records.

Details on Person Jassal, B, 2013-08-21

Class:Id	InstanceEdit:4341656
_displayName	Jassal, B, 2013-08-21
_timestamp	2013-08-21 07:47:20
author	[Person:73447] Jassal, Bijay
dateTime	2013-08-21 11:46:41
(authored)	[FailedReaction:4341669] Defective NEU1 does not hydrolyse Neu5Ac from glycoconjugates [Homo sapiens] [Pathway:4341670] Defective NEU1 causes sialidosis [Homo sapiens]
(created)	[EntityWithAccessionedSequence:4341655] GFPT1 R111C [cytosol] [Homo sapiens] [EntityWithAccessionedSequence:4341657] GFPT1 T147Qfs61 [cytosol] [Homo sapiens] [FragmentReplacedModification:4341658] Replacement of residues 147 to 207 by QTQRQLPSSLSICMTIGKVKIPALLPWWRELSNNWKVLLHLCLKVFIFPGKQLAQGEVALC [Summation:4341659] NEU1 Sialidase 1 (NEU1, neuraminidase, receptor-destroying e... [Summation:4341660] Sialidases have important roles in the degradation of glycoc... [EntityFunctionalStatus:4341661] loss_of_function of GFPT1 mutants [cytosol] [EntityWithAccessionedSequence:4341662] GFPT1 T15A [cytosol] [Homo sapiens] [ReplacedResidue:4341663] L-arginine 111 replaced with L-cysteine [NonsenseMutation:4341664] Nonsense mutation at L-tryptophan 240 [EntityWithAccessionedSequence:4341665] GFPT1 W240 [cytosol] [Homo sapiens] List all 19 refering instances
(edited)	[FailedReaction:4341669] Defective NEU1 does not hydrolyse Neu5Ac from glycoconjugates [Homo sapiens] [Pathway:4341670] Defective NEU1 causes sialidosis [Homo sapiens]
(modified)	[Pathway:3906995] Diseases associated with O-glycosylation of proteins [Homo sapiens] [Pathway:4085011] Defective GNE causes sialuria, NK and IBM2 [Homo sapiens] [Summation:4085019] Glucosamine-fructose 6-phosphate aminotransferases 1 and 2 (... [FailedReaction:4085027] Defective GFPT1 does not transfer an amino group from L-Gln to F6P to form GlcN6P [Homo sapiens] [Summation:4085030] Glucosamine-fructose 6-phosphate aminotransferases 1 and 2 (... [Summation:4087984] Sialidases 1-4 (NEU1-4, neuraminidases, receptor-destroying ... [FailedReaction:4088322] Defective GNE does not phosphorylate ManNAc to ManNAc-6-P [Homo sapiens] [EntityWithAccessionedSequence:4088323] GNE V572L [cytosol] [Homo sapiens] [EntityWithAccessionedSequence:4088351] GNE M171V [cytosol] [Homo sapiens] [EntityWithAccessionedSequence:4088366] GNE C303V [cytosol] [Homo sapiens] List all 17 refering instances
[Change default viewing format]

No pathways have been reviewed or authored by Jassal, B, 2013-08-21 (4341656)